PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016652841.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 129aa    MW: 14764 Da    PI: 10.1847
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016652841.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM133.81.2e-41151291115
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGf+FhP+deel+v+yL++kv +++l++ + i+e+d+yk++Pw+Lp+++  +e+ewyfFs+rd+ky++g r+nra++sgyWka  +dk++l++
  XP_016652841.1  15 LPPGFKFHPSDEELIVHYLRNKVISHPLPA-QLITEIDLYKYNPWELPNNALFGEDEWYFFSPRDRKYPNGVRPNRAAASGYWKAASSDKPILTS 108
                     79****************************.89***************87778999************************************998 PP

             NAM  96 .kgelvglkktLvfykgrapk 115
                      + + +g+kk Lvfy+grapk
  XP_016652841.1 109 rGLKRIGVKKALVFYTGRAPK 129
                     56677*************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-4711129IPR003441NAC domain
PROSITE profilePS5100546.69315129IPR003441NAC domain
PfamPF023656.0E-2116125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MEKVSTFPSS ALQLLPPGFK FHPSDEELIV HYLRNKVISH PLPAQLITEI DLYKYNPWEL  60
PNNALFGEDE WYFFSPRDRK YPNGVRPNRA AASGYWKAAS SDKPILTSRG LKRIGVKKAL  120
VFYTGRAPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-531512920132NAC domain-containing protein 19
3swm_B6e-531512920132NAC domain-containing protein 19
3swm_C6e-531512920132NAC domain-containing protein 19
3swm_D6e-531512920132NAC domain-containing protein 19
3swp_A6e-531512920132NAC domain-containing protein 19
3swp_B6e-531512920132NAC domain-containing protein 19
3swp_C6e-531512920132NAC domain-containing protein 19
3swp_D6e-531512920132NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007207937.16e-87hypothetical protein PRUPE_ppa017586mg
SwissprotA0SPJ62e-57NAMB2_TRITD; NAC transcription factor NAM-B2
TrEMBLM5W7337e-87M5W733_PRUPE; Uncharacterized protein
STRINGVIT_08s0040g02110.t018e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-58NAC domain containing protein 25